PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D13G2212
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 302aa    MW: 33629.1 Da    PI: 7.8352
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D13G2212genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.89.1e-171463148
                     TSSS-HHHHHHHHHHHHHTTTT..-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg..tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+ +++++G++  +W + ++++g++R++k+c++rw++yl
      Gh_D13G2212 14 KGPWSPEEDAKLKAYIEKHGTRggNWIALPHKIGLKRCGKSCRLRWLNYL 63
                     79**********************************************97 PP

2Myb_DNA-binding383.8e-1270112246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++ ++    G++ W+ Ia+ ++ gRt++++k++w++
      Gh_D13G2212  70 GGFSEEEDNIICNLYLSIGSR-WSIIAAQLP-GRTDNDIKNYWNT 112
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.736967IPR017930Myb domain
SuperFamilySSF466899.77E-2711110IPR009057Homeodomain-like
SMARTSM007176.0E-131365IPR001005SANT/Myb domain
PfamPF002491.4E-151463IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-241570IPR009057Homeodomain-like
CDDcd001673.75E-101663No hitNo description
PROSITE profilePS5129416.36368118IPR017930Myb domain
SMARTSM007178.6E-1168116IPR001005SANT/Myb domain
PfamPF002491.0E-1070112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-2371118IPR009057Homeodomain-like
CDDcd001679.43E-872114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAKLKAYIE KHGTRGGNWI ALPHKIGLKR CGKSCRLRWL  60
NYLRPNIKHG GFSEEEDNII CNLYLSIGSR WSIIAAQLPG RTDNDIKNYW NTKLKKKLLG  120
RHKQSDINTN LSDHSNNNNN QFPQGLTNSA MERLQLHLQL QALQNPIFSF YNNPALWPNI  180
LPLQQKVTIQ GASNGSTPNI VMEPAAAATT PLTGDTLVDS KPVAMGPLVS SFRQAEVVDE  240
FVGVQEGGEM AEVDGFDGLK DNMVWWSNGF DAKVGSSNCW DSASSVVQFN EMFKDYELGF  300
NM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25141187108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6162910.0JX616291.1 Gossypium hirsutum clone NBRI_GE60834 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012461851.10.0PREDICTED: transcription factor MYB3-like
SwissprotQ9FKL21e-102MYB36_ARATH; Transcription factor MYB36
TrEMBLA0A0D2VJS10.0A0A0D2VJS1_G
STRINGPOPTR_0018s10390.11e-112(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2433234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.11e-94myb domain protein 36